PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049546
Common NameLOC102592614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 327aa    MW: 35319.4 Da    PI: 7.995
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049546genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822202.41.4e-6221451148
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr.kgskpleeaeaagssasa 88 
                           ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyr +g+kp e++++ g s s+
  PGSC0003DMP400049546   2 TSGTRQPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRkQGCKPVERMDI-GGSVSV 89 
                           5899******************************************************************779****77775.66899* PP

                DUF822  89 spesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvss 148
                           sp+ss+q+s+ +s+ +spv+s+ +sp ss++ s+++ +    ++++sl+p+l++ls+ ss
  PGSC0003DMP400049546  90 SPCSSYQLSPGASYNPSPVSSSIPSPISSHYVSNVQNN----SDPNSLIPWLKNLSSGSS 145
                           *******6666666666666666666666666666533....34489*******998443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-633141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MTSGTRQPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCKEAG  60
WIVEEDGTTY RKQGCKPVER MDIGGSVSVS PCSSYQLSPG ASYNPSPVSS SIPSPISSHY  120
VSNVQNNSDP NSLIPWLKNL SSGSSPSSSK FPHHLCIPGG SISAPVTPPL SSPTASTPRM  180
NDNWENPTAN STWIQQHYPF LPYSTPPSPG RQTPPDSGWL SGVQTPQDGP SSPTFSLVSS  240
NPFGFKEPLS NGGSRMWTPG QSGTCSPAVG PCMDQTGDVP MSDVISAEFA FGSNMKGVVK  300
PWEGERIHEE CISDDLELTL GNSSTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358087.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X1
SwissprotQ9ZV881e-127BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLM1CRN70.0M1CRN7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000732500.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-103BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]